EBI3 Human
目录号 : GP20162Epstein Barr Virus Induced 3 Human Recombinant
Sample solution is provided at 25 µL, 10mM.
;)
,-1-7$$$37316672.jpg');)
;)
;)
$$$36806353.jpg');)
;33(7)%EF%BC%9A546-561$$$37156877.jpg');)
;)
;)
;)
%201124-1138.$$$35908550.jpg');)
%20766-780.$$$37100057.jpg');)
%20418-432.$$$36893736.jpg');)
%EF%BC%9A-240-255.$$$35108512.jpg');)
533-545$$$36543525.jpg');)
%201-13.$$$36600053.jpg');)
;)
| Purity | Greater than 90% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. | Source | Escherichia Coli. |
| Phycical Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. | Shipping Condition | Shipped at Room temp. |
| Synonyms | Interleukin-27 subunit beta; IL-27 subunit beta; IL-27B; Epstein-Barr virus-induced gene 3 protein; EBV-induced gene 3 protein; EBI3; IL27B. | ||
| Amino Acid Sequence | RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK. | ||
| Solubility | It is recommended to reconstitute the lyophilized EBI3 in sterile 10mM Acetic acid not less than 100µg/ml, which can then be further diluted to other aqueous solutions. | ||
| Stability | Lyophilized EBI3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C . Upon reconstitution EBI3 should be stored at 4°C between 2-7 days and for future use below -18°C . Please prevent freeze-thaw cycles. | ||
| Biological Activity | Assay data for Human recombinant EBI3 is based upon qualitative binding to anti-EBI3 antibody. | ||
| Formulation | EBI3 Human Recombinant was lyophilized from a solution containing 10mM Acetic Acid and 0.5% Mannitol. | ||
EBI3 has an induced expression in B lymphocytes in reaction to Epstein-Barr virus infection. EBI3 encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28 kDa protein to form iIL-27. EBI3 drives rapid clonal expansion of naive cd4(+) t-cells. EBI3 strongly synergizes with IL-12 to activate IFN-gamma production of naive cd4(+) t-cells. EBI3 mediates its biologic effects through the cytokine receptor wsx-1/tccr.
Assay data for Human recombinant EBI3 is based upon qualitative binding to anti-EBI3 antibody.
Lyophilized EBI3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C . Upon reconstitution EBI3 should be stored at 4°C between 2-7 days and for future use below -18°C . Please prevent freeze-thaw cycles.