GH Zebrafish
目录号 : GP20343Growth Hormone Zebrafish Recombinant
Sample solution is provided at 25 µL, 10mM.
;)
,-1-7$$$37316672.jpg');)
;)
;)
$$$36806353.jpg');)
;33(7)%EF%BC%9A546-561$$$37156877.jpg');)
;)
;)
;)
%201124-1138.$$$35908550.jpg');)
%20766-780.$$$37100057.jpg');)
%20418-432.$$$36893736.jpg');)
%EF%BC%9A-240-255.$$$35108512.jpg');)
533-545$$$36543525.jpg');)
%201-13.$$$36600053.jpg');)
;)
| Purity | Greater than 99.0% as determined by: (a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE. | Source | Escherichia Coli. |
| Phycical Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. | Shipping Condition | Shipped at Room temp. |
| Synonyms | GH1; GH; GHN; GH-N; hGH-N; Pituitary growth hormone; Growth hormone 1; Somatotropin. | ||
| Amino Acid Sequence | AQRLFNNAVIRVQHLHQLAAKMINDFEEGLMPEERRQLSKIFPLSFCNSDSIETPTGKDETQKSSMLKLLRISFRLIESWEFPSQTLSSTISNSLTIGNPNLITEKLVDLKMGISVLIKGCLDGQPNMDDNDSLPLPFEDFYLTVGETSLRESFRLLACFKKDMHKVETYLRVANCRRSLDSNCTL | ||
| Solubility | It is recommended to reconstitute the lyophilized Zebrafish Growth-Hormone in 0.4% NaHCO3 or water adjusted to pH-9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in a presence of a carrier protein such as BSA or similar. | ||
| Stability | Lyophilized Zebrafish Growth-Hormone although stable at room temperature for at least two weeks, should be stored desiccated below -18°C . Upon reconstitution and filter sterilization GH can be stored at 4°C , pH 9 for up to 4 weeks. For long term storage and more diluted solutions it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. | ||
| Biological Activity | Zebrafish Growth-Hormone is biologically active in PDF-P1 3B9 cells stably transfected with rabbit GH receptors. | ||
| Formulation | The protein was lyophilized from a concentrated (1mg/ml) solution with 0.5% NaHCO3 pH-8. | ||
GH is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed in the pituitary but not in placental tissue as is the case for the other four genes in the growth hormone locus. Mutations in or deletions of the gene lead to growth hormone deficiency and short stature.
Zebrafish Growth-Hormone is biologically active in PDF-P1 3B9 cells stably transfected with rabbit GH receptors.
Lyophilized Zebrafish Growth-Hormone although stable at room temperature for at least two weeks, should be stored desiccated below -18°C . Upon reconstitution and filter sterilization GH can be stored at 4°C , pH 9 for up to 4 weeks. For long term storage and more diluted solutions it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.