IL 1 beta Human, HEK
目录号 : GP20451Interleukin-1 beta Human Recombinant, HEK
Sample solution is provided at 25 µL, 10mM.
Purity | Greater than 95% as obsereved by SDS-PAGE. | Source | HEK. |
Phycical Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. | Shipping Condition | Shipped at Room temp. |
Synonyms | Catabolin; Lymphocyte-activating factor (LAF); Endogenous Pyrogen (EP); Leukocyte Endogenous Mediator (LEM); Mononuclear Cell Factor (MCF); IL1F2; IL-1 beta. | ||
Amino Acid Sequence | APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS. | ||
Solubility | It is recommended to reconstitute the lyophilized IL-1b in sterile PBS containing 0.1% endotoxin-free recombinant HSA. | ||
Stability | LyophilizedIL-1 beta although stable at room temperature for 3 weeks, should be stored desiccated below -18°C . Upon reconstitution IL-1 beta should be stored at 4°C between 2-7 days and for future use below -18°C .For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. | ||
Biological Activity | The specific activity was determined by the dose-dependent stimulation of the proliferation of mouse D10S cells and is typically 0.02-0.08ng/ml. | ||
Formulation | The IL-1 beta was lyophilized from 1mg/ml in 1xPBS. |
Interleukin-1b is produced by activated macrophages, IL-1B stimulates thymocyte proliferation by inducing il-2 release, b-cell maturation and proliferation, and fibroblast growth factor activity. IL1B proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
The specific activity was determined by the dose-dependent stimulation of the proliferation of mouse D10S cells and is typically 0.02-0.08ng/ml.
LyophilizedIL-1 beta although stable at room temperature for 3 weeks, should be stored desiccated below -18°C . Upon reconstitution IL-1 beta should be stored at 4°C between 2-7 days and for future use below -18°C .For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.