ProNGF Human
目录号 : GP20119Pro-Nerve Growth Factor Human Recombinant
Sample solution is provided at 25 µL, 10mM.
;)
,-1-7$$$37316672.jpg');)
;)
;)
$$$36806353.jpg');)
;33(7)%EF%BC%9A546-561$$$37156877.jpg');)
;)
;)
;)
%201124-1138.$$$35908550.jpg');)
%20766-780.$$$37100057.jpg');)
%20418-432.$$$36893736.jpg');)
%EF%BC%9A-240-255.$$$35108512.jpg');)
533-545$$$36543525.jpg');)
%201-13.$$$36600053.jpg');)
;)
Pro NGF is the pro-form of the neurotrophin nerve growth factor. Like the mature protein pro NGF is characterized by the cysteine knot motif consisting of three cysteine bridges. The protein predominantly exists as a non-covalently linked homodimer.Pro-Nerve Growth Factor Human Recombinant produced in E.Coli is a non-glycosylated, polypeptide chain containing 224 amino acids and having a molecular mass of 50KDa.The Pro NGF is purified by proprietary chromatographic techniques.
| Purity | Greater than 95.0% as determined by SDS-PAGE. | Source | Escherichia Coli. |
| Phycical Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. | Shipping Condition | Shipped at Room temp. |
| Synonyms | Human Pro-NGF; ProNGF; NGFB. | ||
| Amino Acid Sequence | MEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA. | ||
| Solubility | It is recommended to reconstitute the lyophilized ProNGF in 1xPBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions. | ||
| Stability | Lyophilized ProNGF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C . Upon reconstitution ProNGF should be stored at 4°C between 2-7 days and for future use below -18°C . Please prevent freeze-thaw cycles. | ||
| Formulation | ProNGF was lyophilized from a 0.2 µM filtered solution of 20mM PB and 250mM NaCl pH 7.2. | ||
Lyophilized ProNGF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C . Upon reconstitution ProNGF should be stored at 4°C between 2-7 days and for future use below -18°C . Please prevent freeze-thaw cycles.