Signaling Pathways(信号通路)

Cat.No. 产品名称 Information

GC52394 LC10 A lipidoid derivative of lithocholic acid

GC52392 Biotin-H10 (trifluoroacetate salt)

Biotin-GGGSGMKMQVRIYLV-OH, Biotin-Gly-Gly-Gly-Ser-Gly-Met-Lys-Met-Gln-Val-Arg-Ile-Tyr-Leu-Val-OH

A biotinylated form of H10

GC52391 306-O12B-3 An ionizable cationic lipidoid

GC52390 Spexin 1 (human, mouse, rat, bovine) (acetate)

Neuropeptide Q, NPQ, NWTPQAMLYLKGAQ-NH2, SPX1

An endogenous peptide and agonist of GAL₂ and GAL₃

GC52389 Caveolin-1 (82-101) amide (human, mouse, rat, porcine, bovine, ovine) (trifluoroacetate salt)

Cav-1, Caveolin-1 Scaffolding Domain Peptide, CSD, CSP, DGIWKASFTTFTVTKYWFYR-NH2

A synthetic peptide fragment of caveolin-1

GC52388 [D-Lys3]-GHRP-6 (trifluoroacetate salt)

D-Lys3-Growth Hormone Releasing Peptide 6, His-D-Trp-D-Lys-Trp-D-Phe-Lys-NH2

An antagonist of GHS-R1a

GC52387 Crosstide (trifluoroacetate salt)

Gly-Arg-Pro-Arg-Thr-Ser-Ser-Phe-Ala-Glu-Gly-OH, GRPRTSSFAEG-OH

A peptide substrate for Akt

GC52385 Myelin Basic Protein (85-99) Peptide Antagonist (trifluoroacetate salt)

EKPKVEAYKAAAAPA-OH, MBP (85-99) Peptide Antagonist

An MBP (85-99) antagonist

GC52384 NFAT Inhibitor (cell-permeable) (trifluoroacetate salt)

Nuclear Factor Activated T cells Inhibitor, RRRRRRRRRRRGGGMAGPHPVIVITGPHEE, 11R-VIVIT

A cell-permeable form of NFAT inhibitor

GC52382 Nogo-66 (1-40) (human, mouse, rat) (trifluoroacetate salt)

NEP1-40, Nogo-40, Nogo-A Inhibitory Peptide, RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2

A peptide fragment of Nogo-A

GC52380 AOD-9604 (acetate) A synthetic lipolytic peptide

GC52378 Cecropin A (trifluoroacetate salt) An antimicrobial peptide

GC52376 BMP2-derived Peptide (trifluoroacetate salt)

Bone Morphogenic Protein 2-derived Peptide, KIPKASSVPTELSAISTLYL-NH2

A synthetic peptide

GC52372 Ac-VDVAD-AFC (trifluoroacetate salt)

N-Acetyl-Val-Asp-Val-Ala-Asp-AFC, N-Acetyl-Val-Asp-Val-Ala-Asp-7-amino-4-Trifluoromethylcoumarin, Caspase-2 Substrate (Fluorogenic)

A fluorogenic substrate for caspase-2

GC52371 Vimentin (G146R) (139-159)-biotin Peptide

Biotin-GQGKSRLRDLYEEEMRELRRQ, Biotin-GQGKSRLRDLYEEEMRELRRQ (X=Citrulline), VIM (G146R) (139-159)-biotin

A biotinylated mutant vimentin peptide

GC52370 Citrullinated Vimentin (R144) (139-159)-biotin Peptide

Biotin-GQGKS(Cit)LGDLYEEEMRELRRQ, Biotin-GQGKSXLGDLYEEEMRELRRQ (X=Citrulline), Citrullinated VIM (R144)-biotin

A biotinylated and citrullinated vimentin peptide

GC52369 Cecropin B (trifluoroacetate salt) An antimicrobial peptide

GC52368 DL-Sulforaphane Glutathione

SFN-glutathione, SFN-GSH, Sulforaphane-GSH

A metabolite of sulforaphane

GC52367 Citrullinated Vimentin (G146R) (R144 + R146) (139-159)-biotin Peptide

Biotin-GQGKS(Cit)L(Cit)DLYEEEMRELRRQ, Biotin-GQGKSXLXDLYEEEMRELRRQ (X=Citrulline), Citrullinated VIM (G146R) (R144 + R146)-biotin

A biotinylated and citrullinated mutant vimentin peptide

GC52365 4-tert-Octylphenol monoethoxylate

NSC 5259, OP1EO

An alkylphenolethoxylate and a degradation product of non-ionic surfactants

GC52364 Vimentin (139-159)-biotin Peptide

VIM (139-159)-biotin

A biotinylated vimentin peptide

GC52363 Citrullinated Histone H3 (R2 + R8 + R17) (2-22)-biotin Peptide

Biotin-A-Cit-TKQTA-Cit-KSTGGKAP-Cit-KQLA, Biotin-AXTKQTAXKSTGGKAPXKQLA (X=Citrulline), Citrullinated Histone H3.1-biotin

A biotinylated and citrullinated histone H3 peptide

GC52362 ENPP3 Inhibitor 4g An ENPP1 and ENPP3 inhibitor

GC52361 AMARA Peptide (trifluoroacetate salt)

AMARAASAAALARRR-OH, H-Ala-Met-Ala-Arg-Ala-Ala-Ser-Ala-Ala-Ala-Leu-Ala-Arg-Arg-Arg-OH

A peptide substrate for AMPK

GC52360 Chymotrypsin Substrate I, Colorimetric (trifluoroacetate salt)

Suc-GGF-pNA, Suc-Gly-Gly-Phe-pNA, Suc-Gly-Gly-Phe-p-Nitroanilide

A colorimetric chymotrypsin substrate

GC52359 ATX-100 An ionizable cationic lipid

GC52358 Malachite Green (chloride)

Basic Green 4, C.I. 4200, C.I. 42000

A triphenylmethane dye

GC52356 1-1(Z)-Hexadecenyl-2-Arachidonoyl-sn-glycero-3-PC

1-1(Z)-Hexadecenyl-2-Arachidonoyl-sn-glycero-3-Phosphocholine, 1-1(Z)-Hexadecenyl-2-Arachidonoyl-sn-glycero-3-Phosphatidylcholine, 16:0p/20:4-PC, PC(P-16:0/20:4), C16(plasm)-20:4-PC, PlgPC 16:0/20:4

A plasmalogen

GC52355 BimS BH3 (51-76) (human) (trifluoroacetate salt)

DMRPEIWIAQELRRIGDEFNAYYARR-OH, Bims (51-76)

A Bim-derived peptide

GC52354 Tertiapin Q (trifluoroacetate salt)

TPN(M13Q), TPNQ

A peptide derivative of tertiapin

GC52351 Citrullinated α-Enolase (R8 + R14) (1-19)-biotin Peptide

Citrullinated Enolase-1-biotin, α-Enolase Peptide (Citrulline Residues 8 + 14)

A biotinylated and citrullinated α-enolase peptide

GC52346 IDR 1002 (trifluoroacetate salt) A synthetic cationic innate defense regulator peptide

GC52344 Bak BH3 (72-87) (human) (trifluoroacetate salt) A Bak-derived peptide

GC52343 113-O12B An ionizable cationic lipidoid

GC52342 P4pal10 (trifluoroacetate salt)

Palmitoyl-SGRRYGHALR-amide, Palmitoyl-SGRRYGHALR-NH2

A PAR4 and FPR2 antagonist and an FFAR2 agonist

GC52339 CAY10793 A quinazolinone-containing compound

GC52338 α-Conotoxin PnIA (trifluoroacetate salt)

α-CtxPnIA, αPnIA

A peptide antagonist of α3β2-subunit containing and α7 nAChRs

GC52336 ENPP1 Inhibitor 43 An ENPP1 inhibitor

GC52334 ENPP1 Inhibitor 4e

cGAMP-compound 4e

An ENPP1 inhibitor

GC52333 DSPE-PEG(2000)-NHS

A PEGylated derivative of DSPE

GC52332 Arimoclomol

BRX-220

A co-inducer of heat shock proteins

GC52331 Lactoyl Phenylalanine

Lac-Phe, N-Lactoyl-Phenylalanine

A secondary metabolite

GC52329 Betamethasone-d5

β-Methasone-d5, SCH 4831-d5

An internal standard for the quantification of betamethasone

GC52328 KYL (trifluoroacetate salt)

KYL Peptide

An EphA4 inhibitor

GC52327 Ciraparantag (trifluoroacetate salt)

PER977

An anticoagulant reversal agent

GC52326 Biotin-PEG4-LL-37 (human) (trifluoroacetate salt) A biotinylated and pegylated form of LL-37

GC52325 MeTC7 A vitamin D receptor antagonist

GC52324 3-(3-Hydroxyphenyl)propionic Acid sulfate

3-HPPA sulfate

A metabolite of certain phenols and glycosides

GC52323 L-Isoleucine-13C6

L-(+)-Isoleucine-13C6

An internal standard for the quantification of L-isoleucine

GC52322 ENPP3 Inhibitor 4t An ENPP3 inhibitor