Search Site
  • 0
    My Cart

    Click Here to Find How Many Items You Have Added:)

qq在线咨询
Home >> Signaling Pathways >> Neuroscience

Neuroscience(神经科学)

Neuroscience

Neurons communicate with each other, effector organs and sensory organs through the neurotransmitter – receptor pathway at synapses. Neurotransmitters can be divided into 4 major groups: 1. Amino acids (glumate, aspartate, serine, glycine and GABA); 2. Monoamines (norepinephrine, epinephrine, dopamine, histamine, and serotonin); 3. Peptides (opioid peptides, substance P, somatostatin); and 4. Others (acetylcholine, NO, nucleosides). read more

Products for  Neuroscience

  1. Cat.No. 产品名称 Information
  2. GC52497 Lactosylceramide (porcine RBC)

    LacCer

     A sphingolipid
  3. GC52496 Sulfatide (bovine) (sodium salt)

    Galactosylceramide I3-sulfate, Ganglioside SM4, I3SO3-GalCer, SM4, Sulfated Galactocerebroside, 3-O-Sulfogalactosylceramide

     A mixture of isolated bovine sulfatides
  4. GC52495 AF-353 (hydrochloride) A dual P2X3 and P2X2/3 receptor antagonist
  5. GC52494 β-Endorphin (rat) (trifluoroacetate salt) An opioid neuropeptide
  6. GC52493 Glucosylceramide (bovine buttermilk)

    GluCers (buttermilk), Glucocerebrosides (buttermilk)

     A sphingolipid
  7. GC52492 Globotriaosylceramide (hydroxy) (porcine RBC)

    Ceramide Trihexosides (bottom spot) (porcine)

     A sphingolipid
  8. GC52491 Globotriaosylceramide (non-hydroxy) (porcine RBC)

    Ceramide Trihexosides (top spot) (porcine)

     A sphingolipid
  9. GC52487 Ganglioside GM4 (chicken egg) (ammonium salt)

    Ganglioside G7, Monosialoganglioside GM4

     A sphingolipid
  10. GC52486 Ceramide Phosphoethanolamine (bovine)

    N-Acyl Ceramide Phosphoethanolamine (d18:1/acyl mixture), CPE, N-acyl-D-erythro-Sphingosylphosphorylethanolamine

     A sphingolipid
  11. GC52484 Purified Ganglioside Mixture (bovine) (ammonium salt) A mixture of purified bovine gangliosides
  12. GC52483 Fucosylated Ganglioside GM1 (porcine) (ammonium salt)

    Fucosylated Monosialoganglioside GM1, Fucosyl GM1

     A sphingolipid
  13. GC52477 Corynoxine (hydrochloride) An indole alkaloid
  14. GC52476 Bax Inhibitor Peptide V5 (trifluoroacetate salt)

    BIP V5, VPMLK

     A Bax inhibitor
  15. GC52473 NVP-AAM077 An NMDA receptor antagonist
  16. GC52453 Orexin A (17-33) (human, mouse, rat, bovine) (trifluoroacetate salt)

    OXA (17-33)

     A peptide orexin receptor 1 agonist
  17. GC52449 Spadin (trifluoroacetate salt)

    YAPLPRWSGPIGVSWGLR

     An inhibitor of K2P2.1/TREK1
  18. GC52438 CGRP (8-37) (mouse, rat) (trifluoroacetate salt)

    Calcitonin Gene-Related Peptide (8-37), CGRP8-37, VTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2

     A CGRP receptor antagonist
  19. GC52424 Bradykinin Fragment (1-5) (trifluoroacetate salt)

    Arg-Pro-Pro-Gly-Phe, BK1-5, RPPGF

     A metabolite of bradykinin
  20. GC52421 (±)-10-hydroxy-12(Z)-Octadecenoic Acid-d5

    10-hydroxy-cis-12-Octadecenoic Acid-d5

     An internal standard for the quantification of (±)-10-hydroxy-12(Z)-octadecenoic acid
  21. GC52419 MOG (35-55) (mouse, rat) (trifluoroacetate salt)

    MEVGWYRSPFSRVVHLYRNGK, Myelin Oligodendrocyte Glycoprotein (35-55)

    An MOG antigen peptide
  22. GC52414 [Ala17]-MCH (trifluoroacetate salt)

    Ala17-Melanin-Concentrating Hormone

     An MCH-derived peptide and MCH receptor agonist
  23. GC52412 TT-232 (trifluoroacetate salt) A synthetic peptide derivative of somatostatin
  24. GC52411 Exendin-4 (5-39) amide (trifluoroacetate salt)

    Exenatide Amide

     An antagonist of the GLP-1 receptor
  25. GC52409 BAM-22P (8-22) (human, mouse, rat, bovine) (trifluoroacetate salt)

    BAM 8-22, Bovine Adrenal Medulla 8-22

     A neuropeptide and MRGPRX1 agonist
  26. GC52407 BAM-22P (human, mouse, rat, bovine) (trifluoroacetate salt)

    Bovine Adrenal Medullary Docosapeptide, YGGFMRRVGRPEWWMDYQKRYG

     A neuropeptide
  27. GC52403 Ivermectin-d2

    22,23-dihydro Avermectin B1-d2

     An internal standard for the quantification of ivermectin
  28. GC52399 Norephedrine-d5 (hydrochloride) An internal standard for the quantification of norephedrine
  29. GC52391 306-O12B-3 An ionizable cationic lipidoid
  30. GC52390 Spexin 1 (human, mouse, rat, bovine) (acetate)

    Neuropeptide Q, NPQ, NWTPQAMLYLKGAQ-NH2, SPX1

     An endogenous peptide and agonist of GAL2 and GAL3
  31. GC52389 Caveolin-1 (82-101) amide (human, mouse, rat, porcine, bovine, ovine) (trifluoroacetate salt)

    Cav-1, Caveolin-1 Scaffolding Domain Peptide, CSD, CSP, DGIWKASFTTFTVTKYWFYR-NH2

     A synthetic peptide fragment of caveolin-1
  32. GC52388 [D-Lys3]-GHRP-6 (trifluoroacetate salt)

    D-Lys3-Growth Hormone Releasing Peptide 6, His-D-Trp-D-Lys-Trp-D-Phe-Lys-NH2

     An antagonist of GHS-R1a
  33. GC52385 Myelin Basic Protein (85-99) Peptide Antagonist (trifluoroacetate salt)

    EKPKVEAYKAAAAPA-OH, MBP (85-99) Peptide Antagonist

     An MBP (85-99) antagonist
  34. GC52382 Nogo-66 (1-40) (human, mouse, rat) (trifluoroacetate salt)

    NEP1-40, Nogo-40, Nogo-A Inhibitory Peptide, RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2

     A peptide fragment of Nogo-A
  35. GC52354 Tertiapin Q (trifluoroacetate salt)

    TPN(M13Q), TPNQ

     A peptide derivative of tertiapin
  36. GC52342 P4pal10 (trifluoroacetate salt)

    Palmitoyl-SGRRYGHALR-amide, Palmitoyl-SGRRYGHALR-NH2

     A PAR4 and FPR2 antagonist and an FFAR2 agonist
  37. GC52332 Arimoclomol

    BRX-220

     A co-inducer of heat shock proteins
  38. GC52331 Lactoyl Phenylalanine

    Lac-Phe, N-Lactoyl-Phenylalanine

    A secondary metabolite
  39. GC52329 Betamethasone-d5

    β-Methasone-d5, SCH 4831-d5

     An internal standard for the quantification of betamethasone
  40. GC52328 KYL (trifluoroacetate salt)

    KYL Peptide

     An EphA4 inhibitor
  41. GC52324 3-(3-Hydroxyphenyl)propionic Acid sulfate

    3-HPPA sulfate

     A metabolite of certain phenols and glycosides
  42. GC52323 L-Isoleucine-13C6

    L-(+)-Isoleucine-13C6

     An internal standard for the quantification of L-isoleucine
  43. GC52310 L-Arginine-13C6 (hydrochloride)

    L-(+)-Arginine-13C6

     An internal standard for the quantification of L-arginine
  44. GC52303 Ethyl Mycophenolate A potential impurity found in commercial preparations of mycophenolate mofetil
  45. GC52283 L-Cysteine-15N-d3

    L-Cys-15N-d3, L-(+)-Cysteine-15N-d3, (R)-Cysteine-15N-d3

     An internal standard for the quantification of L-cysteine
  46. GC52278 Creatine Phosphate (sodium salt hydrate)

    Phosphocreatine

     A phosphorylated form of creatine
  47. GC52274 Y-33075 (hydrochloride)

    RKI-983, SNJ-1656, Y-39983

     An inhibitor of ROCK2
  48. GC52270 Pranoprofen-13C-d3

    Pyranoprofen-13C-d3, Y 8004-13C-d3

     An internal standard for the quantification of pranoprofen
  49. GC52264 Latanoprost tris(triethylsilyl) ether

    Latanoprost-related Compound D

     A precursor in the synthesis of latanoprost
  50. GC52262 Tolterodine Dimer A potential impurity in commercial preparations of tolterodine
  51. GC52251 Imidacloprid Impurity 1 A potential impurity in commercial preparations of imidacloprid

Items 301 to 350 of 3882 total

per page
  2. 5
  3. 6
  4. 7
  5. 8
  6. 9

Set Descending Direction