TPO Human, HEK
目录号 : GP21023Thrombopoietin Human Recombinant, HEK
Sample solution is provided at 25 µL, 10mM.
;)
,-1-7$$$37316672.jpg');)
;)
;)
$$$36806353.jpg');)
;33(7)%EF%BC%9A546-561$$$37156877.jpg');)
;)
;)
;)
%201124-1138.$$$35908550.jpg');)
%20766-780.$$$37100057.jpg');)
%20418-432.$$$36893736.jpg');)
%EF%BC%9A-240-255.$$$35108512.jpg');)
533-545$$$36543525.jpg');)
%201-13.$$$36600053.jpg');)
;)
| Purity | Greater than 95% as obsereved by SDS-PAGE. | Source | HEK. |
| Phycical Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. | Shipping Condition | Shipped at Room temp. |
| Synonyms | Megakaryocyte colony-stimulating factor; Myeloproliferative leukemia virus oncogene ligand; C-mpl ligand; ML; Megakaryocyte growth and development factor; MGDF; TPO; MKCSF; MPLLG; MGC163194; THPO. | ||
| Amino Acid Sequence | SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLG EWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQV RLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGG STLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLK WQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAP DISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG | ||
| Solubility | It is recommended to reconstitute the lyophilized Thrombopoietin in sterile PBS containing 0.1% endotoxin-free recombinant HSA. | ||
| Stability | Lyophilized Thrombopoietin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C . Upon reconstitution TPO should be stored at 4°C between 2-7 days and for future use below -18°C .For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. | ||
| Biological Activity | The activity was determined by the dose-dependent stimulation of the proliferation of MO7e cells, the ED50 is 1.15ng/ml. | ||
| Formulation | The TPO protein was filtered (0.2µm) and lyophilized from 0.74mg/ml in 1xPBS. | ||
Thrombopoietin is a glycoprotein hormone produced mainly by the liver and the kidney that regulates the production of platelets by the bone marrow. It stimulates the production and differentiation of megakaryocytes, the bone marrow cells that fragment into large numbers of platelets.
The activity was determined by the dose-dependent stimulation of the proliferation of MO7e cells, the ED50 is 1.15ng/ml.
Lyophilized Thrombopoietin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C . Upon reconstitution TPO should be stored at 4°C between 2-7 days and for future use below -18°C .For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.