VEGF (121 a.a.) Human, Sf9
目录号 : GP21041Vascular Endothelial Growth Factor (121 a.a.) Human Recombinant, Sf9
Sample solution is provided at 25 µL, 10mM.
Purity | Greater than 95.0% as determined by SDS-PAGE. | Source | Sf9, Insect Cells. |
Phycical Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. | Shipping Condition | Shipped at Room temp. |
Synonyms | Vascular endothelial growth factor A; VEGF-A; Vascular permeability factor; VPF; VEGF; MGC70609. | ||
Amino Acid Sequence | APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPS CVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN KCECRPKKDRARQEKCDKPRR. | ||
Solubility | The lyophilized VEGF121 should be reconstituted in 50mM acetic acid to a concentration not lower than 50µg/ml. | ||
Stability | Lyophilized Vascular Endothelial Growth Factor 121 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C . Upon reconstitution VEGF-121 should be stored at 4°C between 2-7 days and for future use below -18°C .For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. | ||
Biological Activity | Measured in a cell proliferation assay using primary HUVECs. The ED50 for this effect is typically 2-10ng/ml. | ||
Formulation | The protein was lyophilized from a solution containing 50mM acetic acid. |
Vascular endothelial growth factor is an important signaling protein involved in both vasculogenesis and angiogenesis. As its name implies, VEGF activity has been mostly studied on cells of the vascular endothelium, although it does have effects on a number of other cell types (e.g. stimulation monocyte/ macrophagemigration, neurons, cancer cells, kidney epithelial cells ).VEGF mediates increased vascular permeability, induces angiogenesis, vasculogenesis and endothelial cell growth, promotes cell migration, and inhibits apoptosis. In vitro, VEGF has been shown to stimulate endothelial cell mitogenesisand cell migration. VEGF is also a vasodilator and increases microvascular permeability and was originally referred to as vascular permeability factor.Elevated levels of this protein are linked to POEMS syndrome, also known as Crow-Fukase syndrome. Mutations in this gene have been associated with proliferative and nonproliferative diabetic retinopathy.
Measured in a cell proliferation assay using primary HUVECs. The ED50 for this effect is typically 2-10ng/ml.
Lyophilized Vascular Endothelial Growth Factor 121 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C . Upon reconstitution VEGF-121 should be stored at 4°C between 2-7 days and for future use below -18°C .For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.