VEGFC Human HEK
目录号 : GP21051Vascular Endothelial Growth Factor C Human Recombinant HEK
Sample solution is provided at 25 µL, 10mM.
;)
,-1-7$$$37316672.jpg');)
;)
;)
$$$36806353.jpg');)
;33(7)%EF%BC%9A546-561$$$37156877.jpg');)
;)
;)
;)
%201124-1138.$$$35908550.jpg');)
%20766-780.$$$37100057.jpg');)
%20418-432.$$$36893736.jpg');)
%EF%BC%9A-240-255.$$$35108512.jpg');)
533-545$$$36543525.jpg');)
%201-13.$$$36600053.jpg');)
;)
| Purity | Greater than 95% as determined by SDS-PAGE. | Source | HEK293 cells. |
| Phycical Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. | Shipping Condition | Shipped at Room temp. |
| Synonyms | VEGF-C; Vascular endothelial growth factor C; VRP; Flt4 ligand; Flt4-L; Vascular endothelial growth factor-related protein; VEGFC. | ||
| Amino Acid Sequence | FESGLDLSDAEPDAGEATAYASKDLEEQLRSVSSVDELMTVLYPEYWKMYKCQLRKGGWQHNREQANLNSRTEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRVDHHHHHH. | ||
| Solubility | It is recommended to reconstitute the lyophilized VEGFC in 1xPBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions. | ||
| Stability | Lyophilized VEGFC although stable at room temperature for 3 weeks, should be stored desiccated below -18°C . Upon reconstitution VEGFC should be stored at 4°C between 2-7 days and for future use below -18°C . Please prevent freeze-thaw cycles. | ||
| Formulation | VEGFC was lyophilized from a 0.2 µM filtered solution of 20mM Tris-HCl and 150mM NaCl, pH 7.2. | ||
VEGF-C, also known as Vascular Endothelial Growth Factor Related Protein (VRP), is a recently discovered VEGF growth factor family member that is most closely related to VEGF-D. Human VEGF-C cDNA encodes a pre-pro-protein of 416 amino acids residues. It is almost identical to the mouse VEGF-C protein. Similar to VEGF-D, VEGF-C has a VEGF homology domain spanning the middle third of the precursor molecule and long N- and C-terminal extensions. In adults, VEGF-C is highly expressed in heart, placenta, ovary and small intestine. Recombinant human VEGF-C, lacking the N- and C-terminal extensions and containing only the middle VEGF homology domain, forms primarily non-covalently linked dimers. This protein is a ligand for both VEGFR-2/KDR and VEGFR-3/FLT-4. Since VEGFR-3 is strongly expressed in lymphatic endothelial cells, it has been postulated that VEGF-C is involved in the regulation of the growth and/or differentiation of lymphatic endothelium. Although recombinant human VEGF-C is also a mitogen for vascular endothelial cells, it is much less potent than VEGF-A.
Lyophilized VEGFC although stable at room temperature for 3 weeks, should be stored desiccated below -18°C . Upon reconstitution VEGFC should be stored at 4°C between 2-7 days and for future use below -18°C . Please prevent freeze-thaw cycles.